PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G131800.1
Common NameB456_008G131800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 738aa    MW: 81229.3 Da    PI: 6.2503
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G131800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.7e-162468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Gorai.008G131800.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEYIG-TKTAVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.65E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.7631973IPR017930Myb domain
TIGRFAMsTIGR015574.4E-172271IPR006447Myb domain, plants
SMARTSM007171.6E-122371IPR001005SANT/Myb domain
PfamPF002494.2E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-82464IPR009057Homeodomain-like
CDDcd001672.78E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MDTYSSGEEL VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EYIGTKTAVQ  60
IRSHAQKFFS KLEKEALAKG VPIGQALDIE IPPPRPKRKP SNPYPRKTSA ATTVQEGAKD  120
GKSEMPLSSL HCKQMLDLEK EPLPERPTGD EKATNLKENQ DESCSEVFTL LHEQNCSSAS  180
SMNKNFIPMS AALKSSCTFR EFVPLPKEVI FHDNGTSKAS NLEKSCTSYE KSAQGQRKDD  240
LDGAFCADEM QAAQNYPRHV AVHVLDGSLR TCVQNPSLGM SFQDSVFHPM GDVHGPNLFA  300
NPAASATTEH QNNAPKSTHQ ALPPFHIPFI HLRPDQEEYR SFLHVSSTFS NLIVSTLLQN  360
PAAHAAASFA ATFWPYANVE SSGDSPANEL RGFPSTQTNS APSMAAIAAA TVAAATAWWT  420
AHGLLPVCAP LHTGFTCAPA STAAVPPMEN GQTPAANMEQ KDKTDLALTT QDERLDPEYS  480
EALQGQHSAS KSPTSSSSDC EERVDAKANT EVKATDDEKA AEVIEPQDVD KMKNRKQVDR  540
SSCGSNSSSE VETDMLEKLE KDKEDPKGAD PNHPQVECNR RSRSSSNLSD SWKEVSEEGR  600
LAFQALFSRE VLPQSFSPPH DGKNKGQQKE NVGADKQNPV EKDRETSTLD LNRKMLDSRS  660
DSQEVEKNAL SKDEKNNAED GLLRIGLGHA KLKASRTGFK PYKRCSVEAK ENRVMNTGSQ  720
GEERGPKRVR LEGEAST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5261808e-92HQ526180.1 Gossypium herbaceum clone NBRI_E_1400 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437846.10.0PREDICTED: protein LHY-like isoform X2
TrEMBLA0A0D2SZS70.0A0A0D2SZS7_G
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-128MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]